|
 
 |
|
ORIGINAL ARTICLE |
|
|
|
| Year : 2012 | Volume
: 18
| Issue : 3 | Page : 332-339 |
| |
Genetic significance of muscle segment homeo box1 gene in South Indian population for cleft lip and palate
S Prasad Venkanna, Venkatesh Shivani
Department of Oral and Maxillofacial Surgery, Government Dental College, Bangalore, Karnataka, India
| Date of Web Publication | 4-Mar-2013 |
Correspondence Address:
S Prasad Venkanna
BDS, MDS, DNB & PhD, Reader, Department of Oral and Maxillofacial surgery, Govt. dental college, Bangalore-2, Karnataka
India
 Source of Support: None, Conflict of Interest: None
DOI: 10.4103/0971-6866.107988
 Abstract | | |
Background: Oral clefts having a prehistoric existence and the latest scientific technologies have shown new insights in identifying the cause and management. So this is a DNA/gene based study has been presented in this article which comprises the significance of MSX1 gene in cleft samples of major states of South India.
Aims: To evaluate the significance of MSX1 gene in South Indian population having cleft lip and palate.
Settings and Design: Four states of native population were set for the study. From each state renowned cleft operating center was selected with the prior ethical and suitable permission and patient consent was taken. Blood samples were collected from each effected sibling were studied and their details were coded. The collected blood samples were used for DNA isolation, PCR amplification and sequencing.
Materials and Methods: Eighty patients with non-syndromic CL/CLP/CP from various cleft operating centers in southern states (Karnataka, Tamilnadu, Kerala and Andhra Pradesh) with different ethnic/cultural background were taken. Twenty samples (families) were collected from each state and sequenced and compared with earlier data.
Results: Analysis of this study indicates that mutation of either G273A/C or C102G seems to cause cleft formation. In this analysis, we found a novel mutation (414G to T) which is submitted to NCBI Gene data bank (EF065625).
Conclusion: This study supports MSX1 gene leading to cleft lip and palate in the samples studied.
Keywords: Cleft lip and palate, muscle segment homeo box1, polymerase chain reaction, sequencing
How to cite this article:
Venkanna S P, Shivani V. Genetic significance of muscle segment homeo box1 gene in South Indian population for cleft lip and palate. Indian J Hum Genet 2012;18:332-9 |
How to cite this URL:
Venkanna S P, Shivani V. Genetic significance of muscle segment homeo box1 gene in South Indian population for cleft lip and palate. Indian J Hum Genet [serial online] 2012 [cited 2016 Jun 1];18:332-9. Available from: http://www.ijhg.com/text.asp?2012/18/3/332/107988 |
| Introduction | |  |
Oral facial clefts are congenital structural anomalies of the lip or palate that affects 1/1OOO's lives. The prevalence of orofacial clefts varies from 1/500 to 1/2500 births depending upon geographical origin, facial, ethnic backgrounds and socioeconomic status. These individuals after undergoing surgical repairs undergo speech, dental and sociological therapies. The aetiology of orofacial clefts is complex including multiple genetic and environmental factors. Thus the complex aetiology of clefts offers access to find the main cause such as genetic and environmental interactions, which alters the normal craniofacial development.
| Facial Development | | |
Normal facial development begins with migrating mesial crest combining with mesoderm cells. These mesenchymal cells are being responsible for matured face and head. These cells are activated at spectrum of singling molecules, transcriptions and growth factors. Recently a group of genes like TGFA 1 (transforming growth factor Alpha 1), RARA (Retinoic Acid Receptor Alpha), TGFB (transforming growth factor Beta), MSX1 (Muscle segment homeo box 1), PAX1 (paired box 1), TGFA2 (transforming growth factor Alpha 2), PVRL 1 (Polio virus related 1) have been held responsible in the role of development of head particularly in development of lips and palate. [1],[2],[3]
| Environmental Factors | | |
Warkany (1943) 1 st reported that various nutritional deficiencies were responsible for cleft lip/palate. [4] He recognized that teratogens such as Phenytoin, Valproic acid and Thalidomide were responsible for orofacial clefts. [4] The other causes encountered are maternal alcohol drinking/cigarette smoking, involvement of pesticides such as Dioxin. [5] Epidemiological studies for cleft lip/palate conducted till today in various parts of world indicated the involvement of environmental factors for clefts, especially in low economic status people. In Philippines a comparative study between people of high and low socio-economic status showed 1% of cleft lip/palate more in low socio economic group than in high socio group. [6] Like-wise, frequencies of incidence were similar in other Asian group with same socio-economic status. [7] A further increase in these geographical areas occurred whenever there was a history of maternal infections, smoking, alcohol consumptions and vitamin deficiencies during pregnancy. [8],[9]
| Genetics Vitamins and Congenital Factors | | |
Orofacial clefts provide a unique genetic model for detail study. The genetic factors in clefting can be analyzed by various techniques including segregation analysis, additional genetic linkage etc.
Genetic linkage studies cleft lip/palate led to the specification of certain candidate genes situated in chromosomes 2, 4, 6, 17 and 19. [10],[11] Studies from Denmark and Italy reported that loci on 6p have consistently shown linkage to cleft lip/palate. [12] But such study has not been conducted in Indian race till recently. An epidemiological survey was been conducted for cleft lip/palate in and around Chennai population in 1962 and also in Calcutta in 2004. Finally, recent studies from different parts of world have shown the genes TGFA, 84S192, MSX1, TGFB3 and RARA as the most possible candidate gens for orofacial clefts. [6],[7],[8],[13],[14],[15],[16],[17]
In lieu the above evidences some studies have reported that vitamin deficiency, particularly vitamin A, leads to cleft lip/palate formation. Earlier, it was thought that consangual marriages might lead to cleft lip/palate formation. But a report in 2002 which was a comparative study of clefts with consangual and non-consangual families showed no significant difference in the incidence of clefts but, the low socio-economic status families of either group had more incidence of clefts. [1],[9],[10],[11],[17]
| Animal Studies and Reports | | |
Several animal studies have indicated similar features of gene expression as that of in humans. MSX1 gene is proved to be responsible for growth and development for earthworm. [18] Recent studies on chimpanzee reported similar functions of TGF, MSX1, BMP genes as in human beings. [18] Seven types of MSX1 gene found to be responsible for shape and development in Drosophila. Out of these, HOX/MSX7 are similar in function with respect to MSX1 of humans. [19],[20]
| Gene Environment Interaction | | |
Studies exploring the effect of environment factors on gene function leading to cleft lip/palate are relatively rare. Variation of TGFA expression due to smoking during pregnancy leading to cleft has been reported. [17],[21] Vitamin A and its congeners Acutane are known to induce craniofacial anomalies possibly altering TGFB3 expression. Genetic involvement of cleft lip/palate formation due to folate deficiency remains controversial. [18],[22]
| Diagnosis and Prevention | | |
Even though the knowledge of interactions of gene and environmental factors are relatively less but still the detail history related to the interaction may be useful for better diagnosis and prevention of clefts. [23],[24],[25] Studies related to reduction in smoking and consumption of alcohol during pregnancy has shown to lower the risk of having the facial abnormality child. [26] Drugs like anticonvulsant medications have been evaluated carefully and balanced against the risk of withdrawal for a mother affected with seizure disorder during pregnancy as the anticonvulsants are set to be teratogens leading to birth defects (cleft associate defect). [27],[28],[29],[30],[31],[32],[33] With respect to genetic diagnosis, a thorough counselling of any evidences like hypodontia/tooth agenesis and lip pits in pregnant mother should be advised to evaluate MSX1 gene mutations or to rule out any other known gene mutations and syndromes related to the findings. Finally, nutritional supplements such as folic acids, vitamin B6 and micronutrients provided to pregnant mother have proved to be responsible in good morphodifferentiation of the cells and their function provided the gene status is good. [34],[35],[36],[37] In future, gene therapy may be the treatment of choice with proper evaluation, planning and with proper vectors and with target zones/genes in respect to treat the facial defects. [38],[39],[40]
In lieu the above literature, the present genetic study had been conducted to find out the possible alteration (mutation) of the MSX1 gene causing cleft/palate in South Indian population.
| Materials and Methods | | |
Eighty patients with non-syndromic CL/CLP/CP from various cleft operating centers in southern states (Karnataka, Tamilnadu, Kerala and Andhra Pradesh) with different ethnic/cultural background and 20 samples were collected from each state. The data collection was performed in accordance with individual ethical clearance from their cleft operating institute with the informed consent form signed by the patient and it was institutional based research. The DNA was extracted from the blood soaked blotting papers of the patients. Separate numbering was given for each collection zone.
DNA was extracted by standard Phenol/chloroform extraction protocol or disposable DNA extraction kits. The primers designed for Exon1 and Exon2 excluding the intron and UTR (untranslated region) were used for PCR amplification and then the amplified DNA samples were sequenced. To amplify protein binding sites the primers were designed with some modifications of previously published ones. The primer design as follows:
EXON1: Forward primer: 5'- CAT GCC CGG CGG CTG GCC AGT GCT-3'
Reverse primer: 5'- CTG CAG GTA CGC AGG CGC CGG AG-3'
EXON2: Forward primer: 5'- CGG CAC CGA GGC ACT TGG CGG CAC T-3'
Reverse primer: 5'- GAG CAC GTC CGG GGG TAC AGC ACC A-3'
| Gene Information: GENE Muscle Segment Homeo Box1 | | |
[Figure 1]
Gene sequence: Complete coding sequence (894 bp)
ATGACTTCTTTGCCACTCGGTGTCAAAGTGGAG GACTCCGCCTTCGGCAAGCCGGCGGGGGGAGG CGCGGGCCAGGCCCCCAGCGCCGCCGCGGCCAC GGCAGCCGCCATGGGCGCGGACGAGGAGGGGGC CAAGCCCAAAGTGTCCCCTTCGCTCCTGCCCTTC AGCGTGGAGGCGCTCATGGCCGACCACAGGAAG CCGGGGGCCAAGGAGAGCGCCCTGGCGCCCTC CGAGGGCGTGCAGGCGGCGGGTGGCTCGGCGCA GCCACTGGGCGTCCCGCCGGGGTCGCTGGGA GCCCCGGACGCGCCCTCTTCGCCGCGGCCGCT CGGCCATTTCTCGGTGGGGGGACTCCTCAAGC TGCCAGAAGATGCGCTCGTCAAAGCCGAGAGC CCCGAGAAGCCCGAGAGGACCCCGTGGATGCA GAGCCCCCGCTTCTCCCCGCCGCCGGCCAGGC GGCTGAGCCCCCCAGCCTGCACCCTCCGCAAA CACAAGACGAACCGTAAGCCGCGGACGCCCTTC ACCACCGCGCAGCTGCTGGCGCTGGAGCGCAAG TTCCGCCAGAAGCAGTACCTGTCCATCGCCGAGC GCGCGGAGTTCTCCAGCTCGCTCAGCCTCACTG AGACGCAGGTGAAGATATGGTTCCAGAACCGCC GCGCCAAGGCAAAGAGACTACAAGAGGCAG AGCTGGAGAAGCTGAAGATGGCCGCCAAGCCCAT GCTGCCACCGGCTGCCTTCGGCCTCTCCTTC CCTCTCGGCGGCCCCGAGCTGTAGCGGCCGCGGC GGGTGCCTCGCTCTACGGTGCCTCTGGCCC CCAGCGCGCCGCGCTGCCTGTGG CGCCCGTGGGAC TCTACACGGCCCATGTGGG CTACAGCATGTA CCACCTGACATAG
Protein amino acid sequence for msx-l gene: (297 Amino acids)
MTSLPLGVKVEDSAFGKPAGGGAGQAPSAA AATAAAMGADEEGAKPKVSPSLLPFSVEALM ADHRKPGAKESALAPSEGVQAAGGSAQPLG VPPGSLGSLGAPDAPSSPRPLGHFSVGGLLKLPE DALVKAESPEKPERTPWMQSPRFSPPPARRLS PPACTLRKHKTNRKPRTPFTTAQLLALERKF RQYLSIAERAEFSSSLSLTETQVKIWFQN RRAKAKRLQEAELEKLKMAAKPMLPPAA FGLSFGLSFPLGGPAAVAAAAGASLYGA SGPFQRAALPVAPVGLYTAHVGYSMYHLT.
Exon 1 reference sequence:
(451 bp)ATGACTTCTTTGCCACTCGGTGTCA AAGTGGAGGACTCCGCCTTCGGCAAGCCGCG GGGGGAGGCGCGGGCCAGGC CCCCAGCGCCGCCGCGGCCACGGCAGCCGCCA TGGGCGCGGACGAGGAGGGGGC CAAGCCCAAAGTGTCCCCTTCGCTCCTGCCCTCA GCGTGGAGGCGCTCATGGCCGAC CACAGGAAGCCGGGGqCCAAGGAGAGCGCCC TGGCGCCCTCCGAGGGCGTGCAG GCGGCGGGTGGCTCGGCGCAGCCACTGGGCGT CCCGCCGGGGTCGCTGGGAGCCC CGGACGCGCCCTCTTCGCCGCGGCCGCCGGC CATTTCTCGGTGGGGGGACTCCTC AAGCTGCCAGAAGATGCGCTCGTCAAGCCGA GAGCCCCGAGAAGCCCGAGAGGA CCCCGTGGATGCAGAGCCCCCGCTTCTCCCCG CCGCCGGCCA
Exon 2 reference sequence
(443 bp) GGCGGCTGAGCCCCCCAG CCTGCACCCTCCGCAAACACAAGA CGAACCGTAAGCCGCGGACGCCC TTCACCACCGCGCAGCTGCTG GCGCTGGAGCGCAAGTTCCGCAGAA GCAGTACCTGTCCATCGCCGAGCGCGCG GAGTTCTCCAGCTCGCTCAGCCC ACTGAGACGCAGGTGAAGATATGGTTCCAGAA CCGCCGCGCCAAGGCAAAGAGA CTACAAGAGGCAGAGCTGGAGAAGCTGAAGAT GGCCGCCAAGCCCATGCTGCCA CCGGCTGCCTTCGGCCTCTCCTTCCCTCTCG GCGGCCCCGCAGCTGTAGCGGCC GCGGCGGGTGCCTCGCTCTACGGTGCCTCTG GCCCCTTCCAGCGCGCCGCGCTGCCTGTGG CGCCCGTGGGACTCTACACGGCCCATGTGGG CTACAGCATGTACCACCTGACATAG
Intron sequence (2326 bp)
GTGAGTAGCCAGAACCCAGGCGCAGAGGGAG GGGGCCGGGTGGGGGCCGGG TGGGGTGTGGGACCCGAGGGCTCCTGGTG GCCTCCGGCGCCTGCGTACCTGCAGC CGGTGCTAGGGAGCCGT GGGCTGCAAGGCCGG GTCTTGCGCCTCCCTCCACTCCC ACCCAGGAAGAAG GTTCCAGACCTCCTCGCCT TGGCCCAGAGACGCTGCGGGTGG GAGTTAACGGATAGGACACCGATGTCTGGGC ACCCTGTCCTCCTGCCCCCACCAA ACGACCTCAGGGGT CCATGATCCCTCATCTGA TCCCAAACTCTGTTTCATCGGCTT CACCCCAGCGGATGAATGTGTGTGGTGCGG TATCTTCCCTGCACCCGGAGTTTCA CTTTCTCGCAGTAGGAGCTGGTGTCCCCC AGCCCCTCTTCCCTTTCAAGTACCTCT TTGCCTAGAGGTTCCGAAGCTCCTACAGAAT TCTACCTCCCCATGCCCTTTGAGTT TGAGGCAGATAGTTGG TGCTTTGGGCGGAT GGATGATTCAGGGGTGGGGACATTC AGGTTCCAGTGGAGGGGGCGGGGCACC AAGTCAATTAGGGGAAGG CGCCCCCGC TAATCCTATGGGAA GCTCCCAAACGTCTA GGACTGAGCCATTAAAGTGGACTCCA GGTGCCCAAGGCGGTTCGCTCCAAGGCC TCACGGCCCCCTGGCTGCTCTACTCAG AGAACACGCTCGGAGAT ATTTCAGGAGCA CGGGAAATTCCCAAGTTTTCCTCGTT TCCTCCGATTATTTTGCTCGGCATAA TAGCAGCCAGATTTCAATG GCGTGATGCTG AGGAATGATTT TTATCTGGGGATTAAACGTCTTT GAAAGGCCAGTCCCTCCCTAA GCCTAATGGCC GGAGAAGGTGGCCCCGCTC TGGGTTGTCGCCGCTGAAGGGAGTG ACGTTTCTCTCGGCGCCCGCCCCTCGGGCGGCC CGGCGGAAAGCTAGTTGGGGGC CAAGCGCTTCCCGGACTCCCGGTGGCCTCC AGCAGGGAAGAAGCGGGGTGTTAA CACGAGATTTCGTTTGACTCACATCCT GGTGGTCTGAAAGTCCAA AGGATCGTTG TGTTTTCTTT GTTTTGTTTTGTTTTTTCTG TTTGTTTGTGGTTGTTTTTTAGAGAGGT GTGAAAAAATGCATACTTAGGCAAAACCC GCGTGGTGAAACATCTTCGATTTGAATT CACTTTCTGCCGGGAAAGCTGCTGCA TAGGCAAAGTGTCCTTTCCAACGCTTAG GGCCTTGGGCCCCAAGACCCCGAAGTCAA AGCGATCCCGGCTGTGTTGGGATAATTGA GGCAGATAGTTGGTGCTTTGGGCG GATGGATGATTCAGGGGTGGGGACATTC AGGTTCCAGTGGAGGGGGCGGGGCACC AAGTCAATTAGGGGAAGGCGCCCCCGC TAATCCTATGGGAAGCTCCCAAACGTCT AGGACTGAGCCATTAAAGTGGACTCCA GGTGCCCAAGGCGGTTCGCTCCAAGGCCTCAC GGCCCCCTGGC TGCTCTACTCAG AGAACACGC TCGGAGATATTTCAGGAGCA CGGGAAATTCCCAA GTTTTCCTCGTTTCCTCCGATTATTTTGC TCGGCATAATAGCAGCCAGATTTCAAT GGCGTGATGCTGAGGAATGATTTT TATCTGGGGATTAAACGTCTTTGAAAGGC CAGTCCCTCCCTAA GCCTAATGGCCGGA GAAGGTGGCCCCGCTCTGGGTTG TCGCCGCTGAAGGGAGTGACGTTTCTCTCG GCGCCCGCCCCTCGGGCGGCCCGGCG GAAAGCTAGTTGGGGGCCAAGCGCTTCCCGG ACTCCCGGTGGCCTCCAGCAGGGAA GAAGCGGGGTGTTAACACGAGATTTC GTTTGACTCACATCCTGGTGGTCTGAA AGTCCAAAGGATCGTTGTGTTTTCTTTGTTTT GTTTTGTTTTTTCTGTTTGTTTGTGG TTGTTTTTTAGAGAGGTGTGAAAAAAT GCATACTTAGGCAAAACCCGCGTGGTGAA ACATCTTCGATTTGAATTCACTTTCTGCCG GGAAAGCTGCTGCATAGGCAAAGTGTC CTTTCCAACGCTTAGGGCCTTGGGCC CCAAGACCCCGAAGTCAAAGCGATCCCGG CTGTGTTGGGATAAT
PCR
The PCR was performed for 35 cycles in 100 μl and the mater mix composition is as follows:
DNA: 100 ng
dNTP mix (2.5 mM each): 4.0 μl
Forward Primer: 400 ng
Reverse Primer: 400 ng
Hot-start Taq polymerase assay buffer (10X): 1X
Hot-start Taq polymerase Enzyme: 5U
Glass distilled water was added to make up the volume to 100 μl
Sequencing
The PCR product was detected on a 1.5% agarose gel and then extracted from agarose by DNA extraction kit for sequencing.
ABI applied Bio-system incorporated sequencing kit was used for sequencing reaction and data was analyzed on genetic analyzer model no ABI3100.
The results were compared to the published sequence Nr. AF 426432 in NCBI database [Table 1].
| Results and Discussion | | |
Twenty cleft samples from the natives of each state where been studied for genetic analysis. Analysis of exon 1 of MSX1 of samples from different states reveals that except for Andhra Pradesh, more than one single point mutation was found in other states. Moreover, out of these mutations noticed, one of them was a silent mutation (C330T). Finally the result indicated that the cleft samples so collected from Andhra Pradesh had only one point mutation of G to A/C at 273 positions. The importance of this mutation site is further substantiated by the fact that all the samples obtained from the states of Karnataka and Kerala also had the same. However this mutation was not noticed in the samples from Tamilnadu instead a silent mutation at C330T, and point mutation at C102G was noticed. Interestingly, this mutation was also noticed in the samples of Karnataka and Kerala. Therefore, analysis of [Table 1] indicates that mutation of either G273A/C or C102G seems to be quite important for cleft formation and the mutation of G273A/C and C102G as lead to the change of either an acidic amino acid aspartic acid or a bulky, basic amino acid, arginine form a neutral, small amino acid, glycine is clear. So change in amino acid from a small, neutral one to a bulky, charged would have lead to a significant change in the conformation of the protein resulting in a functionally different protein.
In this analysis we also found a novel mutation (414G to T) which is submitted to NCBI Gene data bank (EF065625). We found less data in relation to Andhra zone for MSX1 whereas a good data was available in Kerala. We also noticed some samples produced insignificant sequence due to rich GC content of the gene.
Summary: In this analysis, we also found a novel mutation (414G to T) which is submitted to NCBI Gene data bank (EF065625). We found less data in relation to Andhra zone for MSX1 whereas a good data was available in Kerala. We also noticed some samples produced insignificant sequence due to rich GC content of the gene.
In case of exon 2, though some studies have shown change in amino acid from arginine to serine in position 151 and silent mutations at positions 181 and 275 but in our study we had no significant findings in exon 2. [29]
| Conclusion | | |
In comparison to the previous gene sequence Nr. AF426432 data (NCBI) this research article projects similar reports and positively reflects the genetic implications in South Indian population for MSX1 gene. In spite of multiple cultural/ethnic backgrounds genetic variations were similar in comparison to previous reports. We feel that this study may be the stepping stone for prenatal investigations/counseling and genetic correction through genetic engineering in future days to come for oral clefts.
| Acknowledgement | | |
We are thankful to all of the Dept. head/Prof./directors/deans/of various cleft operating centers in South India who helped us in collecting the required samples. They being
Sir Dr. Prof. Adenwalla and his team - Jubilee Mission Medical College and Hospital, Thrissur, Kerala, India.
Dr. Prof. Mukund Reddy and his team - Dept. of Plastic Surgery NIMS Hyderabad, Andhra Pradesh, India.
Dr. Prof. Gopal Krishnan and his team - Dept. of Facial Plastic and Maxillofacial Surgery S. D. M Dental College Darwad, Karnataka, India.
Dr. Prof. Manikandhan and his team - Dept. of Oral and Maxillofacial Surgery Meenakshi Ammal Dental College Chennai, India.
Besides we are also grateful to NGO organizations of all South Indian states that came forward in providing details of patients' nativity and also providing the basic historical ethnic, cultural and community backgrounds which were required for our study, which helped us while collecting samples.
We also thank all the patients and their families for providing the suitable data and support to make this research project successful.
This research report was the part of the main research program which was registered for Rajiv Gandhi University of Health Sciences Bangalore, Karnataka, India, and it was an Institutional fundamental research and we are still extensively working on it. The detail research program started from 2004-2008 and it was started in A. B. Shetty Dental College which was the first PhD registered dental school for Rajiv Gandhi University of Health sciences and was awarded PhD in Sept 2008.
We are blessed and grateful to Dr. Krishna Shama Roa Sir under whose research guidance (PhD guide) this project was started at A. B. Shetty Dental College, Mangalore, Karnataka, India.
We would also be grateful to CCMB Hyderabad fro providing us the basic genetic knowledge and lab facilities for our research.
We finally wish to thank Dr. Biswajith Roy of Chromous Biotec Bangalore, India who was the technical support and helped in getting the primers design and other lab requirements needed for our study.
| References | | |
| 1. | Field LL, Ray AK, Cooper ME, Goldstein T, Shaw DF, Marazita ML. Genome Scan for Loci Involved in Nonsyndromic Cleft Lip with or Without Cleft Palate in Families from West Bengal, India. Am J Med Genet 2004;130A: 265-71. 
[PUBMED] |
| 2. | Christensen K, Mitchell LE. Familial Recurrence-Pattern Analysis of nonsyndromic isolated Cleft Palate-A Danish registry Study. Am J Hum Genet 1996;58:182-90.
[PUBMED] |
| 3. | Sözen MA, Suzuki K, Tolarova MM, Bustos T, Fernández Iglesias JE, Spritz RA. Mutation of PVRL 1 is associated with sporadic, non-syndromic cleft lip/palate in northern Venezuela. Nat genet 2001;29:141-2.
|
| 4. | MRC Vitamin Study Research Group. Prevention of neutral tube defects. Lancet Nat Genet 1991;338:131-7.
|
| 5. | Romitti PA. Candidate genes for nonsyndromic cleft lip and palate and maternal cigarette smoking and alcohol consumption: Evaluation of genotype-environmental interaction from a population-based case control study of orofacial clefts. Teratology 1999;59:39-50.
|
| 6. | Romitti PA, Munger RG, Murray JC, Daack-Hirsch S, Hinson, Burns TL. The effect of follow up on limiting non participation bias in genetic epidemiological investigations. Euro J Epidemiol 1998;14:129-38.
|
| 7. | Schutte BC, Murray JC. The many faces and factors of orofacial clefts. Hum Mol Genet 1999;8:853-9.
|
| 8. | Blanco R, Chakraborty R, Barton SA, Carreño H, Paredes M, Jara L, et al. Evidence of a sex dependent association between the MSX1 locus and non syndromic cleft lip with or without the cleft palate in the Chilean population. Hum Bio 2001;73:81-9.
|
| 9. | Dausset J, Cann H, Cohen 0, Lathrop M, Lalouel JM, White R. Centre d'etude du polymorphisme humain (CEPH): Collaborative genetic mapping of the human genome. Genomics 1990;6:575-7.
|
| 10. | Devlin B, Risch N. A comparison of linkage disequilibrium measures for fine scale mapping. Genomics 1995;29:311-22.
|
| 11. | Gonzalez SM, Ferland LH, Robert B, Addelhay E. Structural and functional of mouse MSX1 gene promoter: Sequence conservation with human MSX1 promoter points at potential regulatory elements. DNA cell Bio 1998;17:561-72.
|
| 12. | Jaber L, Nahmani A, Halpern GJ, Shohat M. Facial clefting in an Arab town in Israel. Clin Genet 2002;61:448-53.
|
| 13. | Ray AK, Field LL, Marazita ML. Non syndromic cleft lip with or without cleft palate in West Bengal, India: Evidence for an Autosomal Major Locus. Am J Hum Genet 1993;52:1006-11.
|
| 14. | Marazita ML, Field LL, Cooper ME, Tobias R, Maher BS, Peanchitlertkajorn S, et al. Genome scan for loci involved in cleft lip with or without cleft palate, in Chinese multiplex families. Am J Hum Genet 2002;71:349-64.
|
| 15. | Scarel RM, Trevilatto PC, Di Hipólito O Jr, Camargo LE, Line SR. Absence of Mutations in the Homeodomain of the MSX1 gene in Patients with Hypodontia. Am J Med Genet 2000;92:346-9.
|
| 16. | Marazita ML, Field LL, Tunçbilek G, Cooper ME, Goldstein T, Gürsu KG. Genome scans for Loci Involved in Cleft Lip With or Without Cleft Palate in Consanguineous Families from Turkey. Am J Med Genet 2003;126A: 111-220.
|
| 17. | Marazita ML, Murray JC, Lidral AC, Arcos-Burgos M, Cooper ME, Goldstein T, et al. Meta -Analysis of 13 Genome Scans Reveals Multiple Cleft Lip/Palate Genes with Novel Loci on 9q21 and 2q32-35. Am J Hum Genet 2004;75:161-73.
|
| 18. | Daugherty M. Genetics a human perspective. 3 rd ed. Dubuque: Wm. c. Brown Publishers; 1992.
|
| 19. | Hewitt JE, Clark LN, Ivens A, Williamson R. Structure and sequence of a human homeobox gene HOX7. Genomics 1991;11:670-8.
|
| 20. | Padanilam BJ. Charecterization of the human Hox7cDNA and identification of polymorphic markers. Hum Mol Genet 1992;1:407-10.
|
| 21. | Jugessur A. Variants of developmental genes (TGFA, TGFB3, and MSX1) and their association with orofacial clefts: A case-parent triad analysis. Genet Epidemiol 2003;24:1-10.
|
| 22. | Honien MA, Paulozzi IJ. Impact of folic acid fortification of the US food supply on the occurrence of neural tube defects. JAMA 2001;285:2981-6.
|
| 23. | Jezewski PA, Vieira AR, Nishimura C, Ludwig B, Johnson M, O'Brien SE, et al. Complete sequencing shows a role for MSX1 in non-syndromic cleft lip and palate. J Mol Genet 2003;40:399-407.
|
| 24. | Braybrook C, Doudney K, Marçano AC, Arnason A, Bjornsson A, Patton MA, et al. The T-box transcription factor gene TBX22 is matured in X-linked cleft palate and ankyloglossia. Nat Genet 2001;29:179-83.
|
| 25. | Gaspar DA, Matioli SR, de Cássia Pavanello R, Araújo BC, Alonso N, Wyszynski D, et al. Maternal MTHFR interacts with the offspring's BCL3 genotypes, but not with TGFA, in increasing risk to nonsyndromic cleft lip with or without cleft palate. Euro J Hum Genet 2004;12:521-6.
|
| 26. | Jumlongras D, Bei M, Stimson JM, Wang WF, DePalma SR, Seidman CE, et al. A Nonsense Mutation in MSX1 Causes Wit kop Syndrome. Am J Hum Genet 2001;69:67-4.
|
| 27. | van den Boogaard MJ, Dorland M, Beemer FA, van Amstel HK. MSX1 mutation is associated with oro-facial clefting and tooth agenesis in humans. Nat Genet 2000;24:342-3.
|
| 28. | De Muynck S, Schollen E, Matthijs G, Verdonck A, Devriendt K, Carels C. A Novel MSX1 in Hypodontia. Am J Med Genet 2004;128A: 401-3.
|
| 29. | Vanderas AP. Incidence of cleft lip, cleft palate, and cleft lip and palate among races: A review. Cleft Palate J 1987;24:216-25.
|
| 30. | Mooney MP, Siegel MI, editors. Understanding craniofacial anomalies. The etiopathogenesis of craniosynostoses and facial clefting. New York: Wiley-Liss; 2002.
|
| 31. | Stanier P, Moore GE. Genetics of cleft lip and palate: Syndromic genes contribute to the incidence of non-syndromic clefts. Hum Mol Gen 2004;13:73-81.
|
| 32. | Murray JC. Gene/environment causes of cleft lip and/or palate. Clin Genet 2002;61:248-56.
|
| 33. | Gorlin RJ, Cohen MM, Hennekam RC. Syndromes of the head and neck. 4 th ed. New York: Oxford University Press; 2001.
|
| 34. | Nieminen P, Kotilainen J, Aalto Y, Knuutila S, Pirinen S, Thesleff I. MSX1 gene is deleted in Wolf-Hirschhorn syndrome patients with oligodontia. J Dent Res 2003;82:1013-7.
|
| 35. | Suzuki Y, Jezewski PA, Machida J, Watanabe Y, Shi M, Cooper ME, et al. In a Vietnamese population MSX1 variants contribute to cleft lip and palate. Genet Med 2004;6:117-25.
|
| 36. | Lace B, Vasiljeva I, Dundure I, Barkane B, Akota I, Krumina A. Mutation analysis of the MSX1 gene exons and intron in patients with nonsyndromic cleft lip and palate. Stomatologija 2006;8:21-4.
|
| 37. | Chen BY, James HW, editors. PCR Cloning Protocols. 2 nd ed. Methods in Molecular Biology, Volume 192. Totowa, NJ: Humana Press; 2002.
|
| 38. | Text book of Biotechnology. 2 nd ed. New Delhi, INDIA. Willey India Publications. 2005. p. 771-87.
|
| 39. | Singh BD. Editor. Biotechnology 5 th revised and enlarged. India: Kalyani Publishers; 2000. p. 13-22.
|
| 40. | Maxson LR, Daugherty CH, editors. Genetics a human perspective. 3 rd ed. IOWA, USA. Wm. C. Brown Publishers; 1992.
|
[Figure 1]
[Table 1]
|
